SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026378 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026378
Domain Number 1 Region: 653-842
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-46
Family SPRY domain 0.0000279
Further Details:      
 
Domain Number 2 Region: 23-116
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-30
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Domain Number 3 Region: 116-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.41e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026378   Gene: ENSGGOG00000014791   Transcript: ENSGGOT00000026628
Sequence length 844
Comment pep:known_by_projection chromosome:gorGor3.1:11:5560625:5609958:1 gene:ENSGGOG00000014791 transcript:ENSGGOT00000026628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGSERTLQAGNILEIRVGQAGARRVATMTSPVLVDIREEVTCPICLELLTEPLSIDCGH
SFCQACITPNSRESVIGQEGERSCPVCQTSYQPGNLRPNRHLANIVRRLREVVLGPGKQL
KAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQEYQEKFQESLKKLK
NEEQEAEKLTAFIREKKTSWKNQMEPERCRIQTEFNQLRSILDRVEQRELKKLEQEEKKG
LRIIEEAENDLVHQTQSLRELISDLERRCQGSTMELLQDVSDVTERSEFWTLRKPEALPT
KLRSMFRAPDLKRMLRVFRELTDVQSYWAFPHSLYAQEQTADGIRNICSFSINENSHRAK
PNCKDFFKCLAVCNHLIFEEINASLGTGSCQLCTIIRHKEDTNLIKGIFGRETVTKSFSS
EKTQLNVLVTNIEIRKRNLKGSTSSTRSRDFCCSEGEKFSMNVKEAEGRLCFLGEREPLL
RSLHHMVSSEDYQTCSEKLQAALKRLKKEEEEAEKLEADIREEKTSWKYQVQTERQRIQT
EFDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAEDELVQQKQLVRELISDVECRSQWST
MELLQDMSGIMKWSEIWRLKKPKTVSKKLKTVFHAPDLSRMLQMFRELTAVRCYWAVDVT
LNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTAWILG
VYCRTYSRHMKYVVRRCANRQNLYSKYRPLFGYWVIGLQNKCKYGVFEESLSSDPEVLTL
SMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAPMTLC
PPSS
Download sequence
Identical sequences ENSGGOP00000014435 ENSGGOP00000026378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]