SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026409 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026409
Domain Number 1 Region: 44-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000353
Family LIM domain 0.027
Further Details:      
 
Domain Number 2 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000107
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026409
Domain Number - Region: 107-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00119
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026409   Gene: ENSGGOG00000009588   Transcript: ENSGGOT00000031024
Sequence length 341
Comment pep:known_by_projection chromosome:gorGor3.1:17:45908201:45918157:-1 gene:ENSGGOG00000009588 transcript:ENSGGOT00000031024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAGTPLPGSGRQAPGVYTRPNIT
SSSLWPPNLGLLKTGFSSQPVSQILFPCELLHSKGEEENQSRIWFNKVHADLIVQPTEAE
KQNNKTNNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAF
QQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Download sequence
Identical sequences ENSGGOP00000026409 ENSGGOP00000009362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]