SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026466 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026466
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.95e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 67-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000379
Family LIM domain 0.0012
Further Details:      
 
Domain Number 3 Region: 7-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000737
Family LIM domain 0.003
Further Details:      
 
Domain Number 4 Region: 188-233
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000127
Family LIM domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026466   Gene: ENSGGOG00000010054   Transcript: ENSGGOT00000023939
Sequence length 323
Comment pep:known_by_projection chromosome:gorGor3.1:X:133730140:133794213:1 gene:ENSGGOG00000010054 transcript:ENSGGOT00000023939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRF
WHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQP
WHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGKRTVSRVSHP
VSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLYRKNRSLAAPRGPGLVK
APVWWPMKDNPGTTTASTAKNAP
Download sequence
Identical sequences A0A096MZZ1 A0A2I2YQ68 A0A2I3GDF2 A0A2I3RWG4 A0A2J8WX40 A0A2K5J278 A0A2K5XE58 A0A2K6DEB4 A0A2K6L8A2 A0A2K6QGM0 F6PNX5 Q13642
ENSP00000377710 gi|228480211|ref|NP_001153174.1| ENSMMUP00000010401 ENSPANP00000005549 9544.ENSMMUP00000010401 ENSMMUP00000010399 ENSNLEP00000003201 ENSP00000071281 ENSP00000377710 ENSGGOP00000009812 ENSP00000071281 ENSP00000377710 ENSGGOP00000026466 NP_001153174.1.87134 NP_001153174.1.92137 XP_002806456.1.72884 XP_003812379.1.60992 XP_004064976.1.27298 XP_005594743.1.63531 XP_005594744.1.63531 XP_005594746.1.63531 XP_005594747.1.63531 XP_006724807.1.92137 XP_006724808.1.92137 XP_006724809.1.92137 XP_007990994.1.81039 XP_007990995.1.81039 XP_007990996.1.81039 XP_007990997.1.81039 XP_008962970.1.60992 XP_008962971.1.60992 XP_008962972.1.60992 XP_008962973.1.60992 XP_010387415.1.97406 XP_011739218.1.29376 XP_011739219.1.29376 XP_011739220.1.29376 XP_011739221.1.29376 XP_011739223.1.29376 XP_011739224.1.29376 XP_011804159.1.43180 XP_011849788.1.47321 XP_014983768.1.72884 XP_014983769.1.72884 XP_014983770.1.72884 XP_014983771.1.72884 XP_015299383.1.63531 XP_015299384.1.63531 XP_015299385.1.63531 XP_015299387.1.63531 XP_016799730.1.37143 XP_016799731.1.37143 XP_016799732.1.37143 XP_016799733.1.37143 XP_016799734.1.37143 XP_016799735.1.37143 XP_017715301.1.44346 XP_017715302.1.44346 XP_017715303.1.44346 XP_018874722.1.27298 XP_018874723.1.27298 XP_018874724.1.27298 XP_018874725.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]