SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026474 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026474
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily HMG-box 3.4e-17
Family HMG-box 0.0001
Further Details:      
 
Domain Number 2 Region: 80-146
Classification Level Classification E-value
Superfamily HMG-box 6.68e-17
Family HMG-box 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026474   Gene: ENSGGOG00000023427   Transcript: ENSGGOT00000027361
Sequence length 194
Comment pep:novel chromosome:gorGor3.1:16:47510675:47601671:1 gene:ENSGGOG00000023427 transcript:ENSGGOT00000027361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKMTPKKPKGEMSAYAFFMQTCREECKKKNPEVLVNFTEISKKCSERRKTMCGKEKSKPD
EMTEVDEVLYDWEIKNYGPAKGGKKKDPKAPKRLPSGFFLFCSEFCPKDKSTNPGISIGD
VAKRLSEIWNNLSDSAKLPDITTAKLKKCEKGVADSKSKGKFDGAKVKVAWKKVDEEEEE
EEDELKNLEKEEEE
Download sequence
Identical sequences ENSGGOP00000026474 ENSGGOP00000026474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]