SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026485 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026485
Domain Number 1 Region: 76-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026485   Gene: ENSGGOG00000025905   Transcript: ENSGGOT00000031994
Sequence length 173
Comment pep:known_by_projection chromosome:gorGor3.1:12:107244409:107245132:1 gene:ENSGGOG00000025905 transcript:ENSGGOT00000031994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRGALRLDAARWEWARSGCARRRQ
YLTVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIG
YIKHLQELLERQARGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
Download sequence
Identical sequences G3SEF3
ENSGGOP00000026485 ENSGGOP00000026485 XP_004053873.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]