SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026490 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026490
Domain Number 1 Region: 268-323
Classification Level Classification E-value
Superfamily CCCH zinc finger 4.32e-20
Family CCCH zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 240-266
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000327
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 213-237
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000196
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026490   Gene: ENSGGOG00000001665   Transcript: ENSGGOT00000024598
Sequence length 1129
Comment pep:known_by_projection chromosome:gorGor3.1:2a:110110142:110150292:1 gene:ENSGGOG00000001665 transcript:ENSGGOT00000024598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKRRKREKHKHNSPSSDDSSDYSLDSDVEHTESSHKKRTGFYRDYDIPFTQRGHISGSY
ITSKKGQHNKKFKSKEYDEYSTYSDDNFGNYSDDNFGNYGQETEEDFANQLKQYRQAKET
SNIALGSSFSKESGKKQRMKGVQQGIEQRVKSFNVGRGRGLPKKIKRKERGGRTNKGPNV
FSVSDDFQEYNKPGKKWKVMTQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAEL
EKRKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHDDLTKETKKLL
DKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFS
DDFRKIPSLFEIVVKPTVDLAHKIGRKPPAFYNSASPPGPQFQGSSPHPQHIYSSGSSPG
PGPNMSQGHSSPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGVLVQPDT
SLTPPSMGGAYHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDN
YYAQHSIHNFQPPNNSGDGMWHGEFAQQQPPVVQDSPNHGSGSDGSSTRTGHGPLPVPGL
LPAVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEEDDTVNWYSSSEEEEGSSVKSILKTL
QKQTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRKPSESAPLDLR
LAWDPRKLRGNGSGHIGSSVGGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIP
LDASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINL
PLPPLIADQRLNRLWNTKSDLHQNTVSIDPKLAAKAKINTTNREGYLEQFGDSHGSGAKL
GDPRLQKNFDPRLHRLPNTESHQVVMKDSHTSKGAPHLSRSNPGSSQPSGAGTSNSGSGA
LPPYAPKLSSSAGLPLGTSTSVLSGISLYDPRDHGSSSTSELATASSGENSKNQKKSGGL
KSSDKNEPSPGEAILPQKTNPNVEVTLDGPADPQADVPRSSGKVQVPAVHSLPVQALTGL
IRPQYSDPRQARQPGQGSPTPDNDPGREADDKSLKEVFKTFDPTASPFC
Download sequence
Identical sequences ENSGGOP00000026490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]