SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026499 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026499
Domain Number 1 Region: 293-330
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000198
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 62-186
Classification Level Classification E-value
Superfamily PA domain 0.00000445
Family PA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026499
Domain Number - Region: 33-69
Classification Level Classification E-value
Superfamily Glycerate kinase I 0.0863
Family Glycerate kinase I 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026499   Gene: ENSGGOG00000023601   Transcript: ENSGGOT00000022732
Sequence length 437
Comment pep:known_by_projection chromosome:gorGor3.1:4:150920585:151188753:-1 gene:ENSGGOG00000023601 transcript:ENSGGOT00000022732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSLIQACCSLALSTWLLSFCFVHLLCLDFTVAEKEEWYTAFVNITYAEPAPDPGAGAA
GGGGAELHTEKTECGRYGEHSPKQDARGEVVMASSAHDRLACDPNTKFAAPTHGKNWIAL
IPKGNCTYRDKIRNAFLQNASAVVIFNVGSNTNETITMPHAGVEDIVAIMIPEPKGKEIV
SLLERNITVTMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANA
RDRNQRRLGDAAKKAISKLQIRTIKKGDKVIAASFLFGEELFKGYRRSKMYGSHCRHLFH
KSCVDPWLLDHRTCPMCKMNILKALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTT
VNESSVTLDPAVRTVGALQVVQDTDPIPQEGDVIFTTNSEQEPAVSSDSDISLIMAMEVG
LSDVELSTDQDCEEVKS
Download sequence
Identical sequences ENSGGOP00000026499 ENSGGOP00000026499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]