SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026523 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000026523
Domain Number - Region: 133-192
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0119
Family DNA-binding N-terminal domain of transcription activators 0.015
Further Details:      
 
Domain Number - Region: 11-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0547
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026523   Gene: ENSGGOG00000023849   Transcript: ENSGGOT00000032673
Sequence length 253
Comment pep:known_by_projection chromosome:gorGor3.1:12:27324336:27336114:1 gene:ENSGGOG00000023849 transcript:ENSGGOT00000032673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIIMKLKEQHSKIDMVHRNKSEGFFLDASRHILEAPQHGLERRHLEANQNELQAHVDQIT
EMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDASESTSLS
ALVTNSDLSLRKS
Download sequence
Identical sequences A0A096MWG9 A0A0D9R5P9 A0A2I3FZT3 A0A2K5JWX2 A0A2K5P4V7 A0A2K5VDJ4 A0A2K5ZBD1 A0A2K6BD79 A0A2K6MEQ4 A0A2K6PEZ5 G3SEJ1 H2Q5M7 I0FM31 Q9NVK5
gi|24308111|ref|NP_056448.1| ENSGGOP00000026523 ENSP00000229395 9598.ENSPTRP00000008165 9606.ENSP00000229395 ENSPTRP00000008165 ENSP00000229395 ENSPANP00000004225 ENSNLEP00000006549 ENSPTRP00000008165 ENSGGOP00000026523 ENSP00000229395 ENSNLEP00000006549 NP_056448.1.87134 NP_056448.1.92137 XP_001143937.1.37143 XP_003265675.1.23891 XP_003828906.1.60992 XP_005570481.1.63531 XP_007966185.1.81039 XP_010378158.1.97406 XP_010378159.1.97406 XP_011757439.1.29376 XP_011802369.1.43180 XP_011802370.1.43180 XP_011857799.1.47321 XP_011857800.1.47321 XP_011949156.1.92194 XP_012357858.1.23891 XP_015006634.1.72884 XP_017719984.1.44346 XP_018894317.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]