SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026524 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026524
Domain Number 1 Region: 27-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-55
Family SPRY domain 0.0000151
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026524
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily F-box domain 0.00036
Family F-box domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026524   Gene: ENSGGOG00000014199   Transcript: ENSGGOT00000028476
Sequence length 234
Comment pep:known_by_projection chromosome:gorGor3.1:3:198230788:198250371:1 gene:ENSGGOG00000014199 transcript:ENSGGOT00000028476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQH
AFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIG
IATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRV
ILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences ENSGGOP00000026524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]