SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026525 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026525
Domain Number 1 Region: 103-370
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.18e-58
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000158
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026525   Gene: ENSGGOG00000013039   Transcript: ENSGGOT00000030978
Sequence length 371
Comment pep:known_by_projection chromosome:gorGor3.1:16:62322110:62328341:1 gene:ENSGGOG00000013039 transcript:ENSGGOT00000030978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRT
EGDGVYTLNNEKQWINKAVGDKLPECEAVYTLNDKKQWINKAVGDKLPECEAVCGKPKNP
ANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAK
DIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKNYAEV
GRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILN
EHTFCAGMSKYQEDTCYGDAGSAFAIHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSI
QDWVQKTIAEN
Download sequence
Identical sequences G3RSR8
ENSGGOP00000026525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]