SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026559 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026559
Domain Number 1 Region: 186-300,422-568
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.54e-65
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 10-171
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.22e-20
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 324-419
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000497
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026559   Gene: ENSGGOG00000009569   Transcript: ENSGGOT00000022845
Sequence length 657
Comment pep:known_by_projection chromosome:gorGor3.1:X:120697818:120801782:1 gene:ENSGGOG00000009569 transcript:ENSGGOT00000022845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSFHIILSTLTDMGFADILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPE
AKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERA
LKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDS
ASSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGD
GKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKP
QKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPP
DPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLT
VERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKT
TADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNA
VNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGL
AMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences ENSGGOP00000026559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]