SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026587 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026587
Domain Number 1 Region: 121-269
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-23
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026587   Gene: ENSGGOG00000010963   Transcript: ENSGGOT00000024403
Sequence length 338
Comment pep:known_by_projection chromosome:gorGor3.1:1:213859989:213919391:1 gene:ENSGGOG00000010963 transcript:ENSGGOT00000024403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTNILSSLG
GYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQV
VAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYN
QKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQ
LSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Download sequence
Identical sequences ENSGGOP00000010687 ENSGGOP00000026587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]