SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026624 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026624
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 1.23e-48
Family Globins 0.000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026624   Gene: ENSGGOG00000024685   Transcript: ENSGGOT00000029752
Sequence length 142
Comment pep:known_by_projection chromosome:gorGor3.1:16:180030:199233:1 gene:ENSGGOG00000024685 transcript:ENSGGOT00000029752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTKTEGTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHG
SKVVAAVGDAVKSIDNIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTA
EAHAAWDKFLSVVSSVLTEKYR
Download sequence
Identical sequences A0A2J8IND7 P06347
ENSGGOP00000026624 XP_003809440.1.60992 XP_016784461.1.37143 ENSGGOP00000026624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]