SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026653 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026653
Domain Number 1 Region: 625-699
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 9.81e-27
Family Delta-sleep-inducing peptide immunoreactive peptide 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026653   Gene: ENSGGOG00000024379   Transcript: ENSGGOT00000029229
Sequence length 711
Comment pep:known_by_projection chromosome:gorGor3.1:3:150880013:150932085:1 gene:ENSGGOG00000024379 transcript:ENSGGOT00000029229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKMPAKKKSCFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE
EVCERSSSEETLNNVGDAETPGTVSPNLLLDGQLAAAAAAPANGGGVVSARSVSGALAST
LAAAATSAPASGAPGGPQLAGSSAGPVTAAPSQPPTTCTSRFRVIKLDHGSGEPYRRGRW
TCMEYYERDSDSSVLTRSGDCIRHSSTFDQTAERDSGLGATGGSVVVVVASMQGAHGPES
GTDSSLTAVSQLPPSEKMSQPTPAQPQSFSVGQPQPPPPPVGGAVAQSSAPLPPFPGAAT
GPVQPSRASEALQQHVAGLQPPSPAQPSSTGAAASPATAATLPVGTGQNASSVGAQLMGA
SSQPSEAMAPRTGPAQGGQVAPCQPTGVPPATVGGVVQPCLGPAGAGQPQSVPPPQMGGS
GPLSAVPGGPHAVVPGVPNVPAAVPAPSVPSVSTTSVTMPNVPAPLAQSQQLSSHTPVSR
SSSIIQHVGLPLAPGTHSAPTSLPQSDLSQFQTQTQPLVGQVDDTRRKSEPLPQPPLSLI
AENKPVVKPPVADSLANPLQLTPMNSLATSVFSIAIPVDGDEDRNPSTAFYQAFHLNTLQ
ESKSLWDSASGGGVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELVERNSLLERE
NALLKSLSSNDQLSQLPTQQANPGSTSQQQAVIAQPPQPTQPPQQPNVSSA
Download sequence
Identical sequences G3SEW9
ENSGGOP00000026653 ENSGGOP00000026653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]