SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026663 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026663
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily L domain-like 6.24e-37
Family Ngr ectodomain-like 0.004
Further Details:      
 
Domain Number 2 Region: 310-427
Classification Level Classification E-value
Superfamily Hormone receptor domain 9.29e-17
Family Hormone receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 240-343
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000313
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026663
Domain Number - Region: 762-849,922-938
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00863
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number - Region: 718-953,988-1081
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0705
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026663   Gene: ENSGGOG00000026666   Transcript: ENSGGOT00000027917
Sequence length 1321
Comment pep:known_by_projection chromosome:gorGor3.1:4:22466129:22596536:-1 gene:ENSGGOG00000026666 transcript:ENSGGOT00000027917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGRRRGRAQPPLLLQLSLLALLALLGGGGGGGAAALPAGCKHDGRPRGAGRAAGAAE
GKVVCSSLELAQVLPPDTLPNRTVTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSI
DPGAFWGLSSLKRLDLTNNRIGCLNADVFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLR
SLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLE
LPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIH
NCSLIASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGD
FRWPRTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDV
TRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSK
ELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNI
ALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL
ALKNTIVEASIQLPPSLFSPKQKRELRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDG
KRRTVVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGC
HILYSDENITTIQCYSLSNYAVLMDLTGSELYTQAASLLHPVVYTTAIILLLCLLAVIVS
YIYHHSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASVCQAVGIILHYSTLATV
LWVGVTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNY
GSRPNAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQ
RLAANENGEVNHQDSMSLSLISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLY
YPLDLVFSFVFGATCLSFSAFFMVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNSN
GTNGEAPKCPNSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHANSLPLNSTPQLDN
SLTEHSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEG
SVQNGLPKSRLGNNEGHSRSRRAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTS
SKKDALRKPAVVELENQQKSYGLNLAIQNGPIKSNGQEGPLLGTDSTGNVRTGLWKHETT
V
Download sequence
Identical sequences ENSGGOP00000026663 ENSGGOP00000026663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]