SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026678 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026678
Domain Number 1 Region: 8-65
Classification Level Classification E-value
Superfamily SAP domain 8.24e-19
Family SAP domain 0.0000363
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026678
Domain Number - Region: 323-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00189
Family PHD domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026678   Gene: ENSGGOG00000016852   Transcript: ENSGGOT00000031320
Sequence length 651
Comment pep:known_by_projection chromosome:gorGor3.1:15:47425663:47525778:1 gene:ENSGGOG00000016852 transcript:ENSGGOT00000031320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTFCFFSKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALKNRKTSSSMDSALEMISLNVLCLCKLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Download sequence
Identical sequences ENSGGOP00000026678 ENSGGOP00000026678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]