SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026682 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026682
Domain Number 1 Region: 340-496,541-584
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-46
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000026682
Domain Number - Region: 111-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026682   Gene: ENSGGOG00000005777   Transcript: ENSGGOT00000031156
Sequence length 628
Comment pep:known_by_projection chromosome:gorGor3.1:8:38309099:38344004:1 gene:ENSGGOG00000005777 transcript:ENSGGOT00000031156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAGPGQEAGAGPGPGAAANATGAEEGEMKPVAAGAAAPPGEGTSAAPTVEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGY
GQGDVLGFYINLPEDTETAKSLPDTYKDKNTMDLFKSHIYTDYKMVSNVVAKLKTQDSSE
IIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWG
AVVEHTLADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences ENSGGOP00000005661 ENSGGOP00000026682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]