SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026693 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026693
Domain Number 1 Region: 6-151
Classification Level Classification E-value
Superfamily L domain-like 1.48e-28
Family U2A'-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026693   Gene: ENSGGOG00000015417   Transcript: ENSGGOT00000031505
Sequence length 247
Comment pep:known_by_projection chromosome:gorGor3.1:15:48132872:48176263:-1 gene:ENSGGOG00000015417 transcript:ENSGGOT00000031505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK
LNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFN
CEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDED
AQVVSGEEEESRSPMGREACLTGTSDEDEEGYNDGEVDDEEEEEELGEEERGQKRKREPE
DEGEDDD
Download sequence
Identical sequences ENSGGOP00000026693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]