SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026696
Domain Number 1 Region: 31-82
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000671
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026696   Gene: ENSGGOG00000002665   Transcript: ENSGGOT00000029170
Sequence length 111
Comment pep:novel chromosome:gorGor3.1:17:92582603:92588477:1 gene:ENSGGOG00000002665 transcript:ENSGGOT00000029170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVWVLSRLLSAPRLTLAKAVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDL
VVFGRACALSIAESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSEL
Download sequence
Identical sequences ENSGGOP00000026696 ENSGGOP00000026696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]