SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026702 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026702
Domain Number 1 Region: 315-459
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 4.71e-37
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0038
Further Details:      
 
Domain Number 2 Region: 26-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.61e-29
Family G proteins 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026702   Gene: ENSGGOG00000009860   Transcript: ENSGGOT00000022026
Sequence length 544
Comment pep:known_by_projection chromosome:gorGor3.1:11:60438452:60477597:-1 gene:ENSGGOG00000009860 transcript:ENSGGOT00000022026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPQRVAAAASRGAGDAMESSKPGPVQVVLVQKDQHSFELDEKALASILLQDHIRDLDV
VVVSVAGAFRKGKSFILDFMLRYLYSQKESGHSNWLGDPEEPLTGFSWRGGSDPETTGIQ
IWSEVFTVEKPGGKKVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQE
DDLQQLQKMLFCEYSRVGCNSGLFKKTRVTLMFLVRDWSFPYEYSYGLQGGMAFLDKRLQ
VKEHQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDGKLKDIAGEFKEQLQALI
PYVLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAEANNLAAAA
SAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQEL
EEEIKELYENFCKHNGSKNVFSTFRTPAVLFTGIVALYIASGLTGFIGLEVVAQLFNCMV
GLLLIALLTWGYIRYSGQYRELGGAIDFGAAYVLEQASSHIGNSTQATVRDAVVGRPSMD
KKAQ
Download sequence
Identical sequences ENSGGOP00000026702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]