SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026745 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026745
Domain Number 1 Region: 40-64
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000072
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026745   Gene: ENSGGOG00000005496   Transcript: ENSGGOT00000032436
Sequence length 1476
Comment pep:known_by_projection chromosome:gorGor3.1:13:28108739:28203891:-1 gene:ENSGGOG00000005496 transcript:ENSGGOT00000032436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTAETQCRNWLKTGNCLYGNTCRFV
HGPSPRGKGYSSNYRRSPERPTGDLRERMKNKRQDVDTEPQKRNTEESSSPVRKESSRGR
HREKEDIKITKERTPESEEENVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMKL
EQENMEKREEIIIKKEVSPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTSAV
SSPLLDQQRNSKTNQSKKKGPRTPSPPPPIPEDIALGKKYKEKYKVKDRIEEKTRDGKDR
GRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQ
RTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDT
RGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSR
EMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSR
TEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETRS
SYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR
EERRVDRVDDRRDERDRERDRDRDHDKERERQRDWEDKDKGRDDRREKREEIREDRNPRD
GHDERKSKKRYRNEGSPSPRQSPKRRREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRS
LSPSHLTEDRQGRWKEEDRKPERKESSRRYEEQELKEKVSSVDKQREQTEILESSRMRAQ
DIIGHHQSEDRETSDRAHDENKKKAKIQKKPIKKKKEDDVGIERGNIETTSEDGQVFSPK
KGQKKKSIEKKRKKSKGDSDISDEEAAQQSKKKRGPRTPPITTKEELVEMCNGKNGILED
SQKKEDTAFSDWSDEDVPDRTEVTEAEHTATATTPGSTPSPLSSLLPPPPNNTFASEDSH
RKCHRTRAEKVETPHMTVEDAQHRKPMDQKRSSSLGSNRSNRSHTSGRLRSPSNDSAHRS
GDDQSGRKRVLHSGSRDREKTKSLEITGERKSRIDQLKRGEPSRSTSSDRQDSRSHSSRR
SSPESDRQVHSRSGSFDSRDRLQERDRYELISDPVERDRDRDRTFESSQIESVKRCEAKL
EGEHERDLESTSRDSVALDKERMDKDLGSVQGFEDTNKSERTESLEAGDDESKLDDAHSL
GSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDWSGLMPKHPKEPRE
PGAALLKFTPGAVMLRVGISKKLAGSELFAKVKETCQRLLEKPKKDADNLFEHELGALNM
AALLRKEERASLLSNLGPCCKALCFRRDSAIRKQLVKNEKGTIKQAYTSAPMVDNELLRL
SVRLFKRKTTCHAPGHEKTEDNKLSQSSIQQELCVS
Download sequence
Identical sequences ENSGGOP00000026745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]