SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026775 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026775
Domain Number 1 Region: 12-101
Classification Level Classification E-value
Superfamily EF-hand 5.93e-22
Family S100 proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026775   Gene: ENSGGOG00000025778   Transcript: ENSGGOT00000028201
Sequence length 105
Comment pep:novel chromosome:gorGor3.1:7:5586258:5586575:1 gene:ENSGGOG00000025778 transcript:ENSGGOT00000028201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTLQKSPALQRLSIESLISLFQKYVGKRGYNCTLPKTEFLSFMNAELAAFTKNQKDPGVL
DHVMKKLGTNNDGQLDFSEFLKLIGGLAMACHDSFLKAVPSQKQT
Download sequence
Identical sequences ENSGGOP00000026775 ENSGGOP00000026775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]