SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026797 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026797
Domain Number 1 Region: 42-102
Classification Level Classification E-value
Superfamily L domain-like 0.000000187
Family Ngr ectodomain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026797   Gene: ENSGGOG00000016928   Transcript: ENSGGOT00000030393
Sequence length 305
Comment pep:known_by_projection chromosome:gorGor3.1:19:18773845:18780302:-1 gene:ENSGGOG00000016928 transcript:ENSGGOT00000030393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTLAWTLLLPLLLLESDSLELSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRA
SNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL
ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCVPGLASATIRAVVVSGCLLLGLA
IAGPVLAWRLWRCRVARSRELDKPWAAQDGPKPGLGLQPRYGSRSAPKPQVAVPSCPSTP
DYENMFVGQPAAEHQWDEQGAHPSEDNDFYMNYKDIDLASQPVYCNLQSLGQAPMDEEEY
VIPGH
Download sequence
Identical sequences G3RL81
ENSGGOP00000016519 ENSGGOP00000026797 XP_004060347.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]