SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026802
Domain Number 1 Region: 9-36,147-211
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000181
Family Calbindin D9K 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026802   Gene: ENSGGOG00000002477   Transcript: ENSGGOT00000027778
Sequence length 1340
Comment pep:known_by_projection chromosome:gorGor3.1:20:26098821:26165377:-1 gene:ENSGGOG00000002477 transcript:ENSGGOT00000027778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSHLQFTQVNFEEFKEGFVAVLSSNAGVRPSDEDSSSLESAASSAIPPKCVNGSKWYGR
RSRPELCDAATEARRVPEQQTQASLKSHLWHSASLESVESLKSDEEAESTKEAQNELFEA
QGQLQTWDSEDFGSPQKSCSPSFDTPESQIRGMWEELGVGSSGHLSEQELAVVCQSVGLQ
GLEKEELEDLFNKLDQDGDGKVSLEEFQLGLFSHEPALLLESSTRVKPSKAWSHYQVPEE
SGCHTTTTSSLVSLCSSLRLFSSIDDGSGFAFPDQVLAMWTQEGIQNGREILQSLDFSVD
EKVNLLELTWALDNELMTVDSAVQQAALACYHQELSYQQGQVEQLARERDKARQDLERAE
KRNLEFVKEMDDCHSPXXXXXXXXXXHLEQGYRERLSLLRSEVEVERELFWEQAHRQRAA
LEWDVGRLQAEEAGLREKLTLALKENSRLQKEIVEVVEKLSDSERLALKLQKDLEFVLKD
KLEPQSAELLAQEERFAAVLKEYELKCRDLQDRNDELQAELEGLWARLPKNRHSPSWSPD
GHRRQLSGLGPAGISFLGNSAPVSIETELMMEQVKEHYRDLRTQLETKVNYYEREIAALK
RNFEKETKDMEQARRREVSVLEGQKADLEELHEKSQEVIWGLQEQLQDTARSPEPEQMGL
APCCTQALCGLDLQHQSHLQQIRKEAEAELSGEPSGLGALLARRDLTLELEEPPPGPLPR
GSQRSEQLELERALKLQPCASEKRAQMCVSLALEEEELELARGKRVDGPSREAEMLQALP
KDGLVAGSGREGARGLLPLRPGCGERPLPWLAPGDERESEEAAGAGPRCRQAQDTEATQS
PAPAPAPASHGPSERWSRMQPCEVDGDIVPKEPEPFGASAAGLEQPGARELPLLGTERDA
SQTQPRMWEPPLRPAASCRGRAERPQAIQEERARSWSRGTQEQASEQQARAEGAVEPGCH
KHSVEVARRGSLPSHLQLADPQGSWQEQLAAPEEGETKIALEREKDDMETKLLHLEDVLR
ALEKHVDLRESDRLEFHRLSEENTLLKNDLGRVRQELEAAESTHDAQRKEIEVLKKDKEK
ACSEMEVLNRQNQNYKDQLSQLNVRVLQLGQEASTHKAQNEEHRVTIQMLTQSLEEVVRS
GQQQSDQIQKLRVELECLNQEHQSLQLPWSELTQTLEESQDQVQGAHLRLRQAQAQHLQE
VRQLQEQMGRLVPQDHVAELQRLLSLQGEQARRRLDAQREEHEKQLKATEERVEEAEMIL
KNMEMLLQEKVDKLKEQFEKNTKSDLLLKELYVENAHLVRALQATEEKQRGAEKQSRLLE
EKVRALNKLVSRIAPAALSV
Download sequence
Identical sequences ENSGGOP00000026802 ENSGGOP00000026802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]