SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026818 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026818
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HSP20-like chaperones 6.98e-38
Family Co-chaperone p23-like 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026818   Gene: ENSGGOG00000027957   Transcript: ENSGGOT00000024546
Sequence length 160
Comment pep:novel chromosome:gorGor3.1:12:54769417:54796049:-1 gene:ENSGGOG00000027957 transcript:ENSGGOT00000024546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Download sequence
Identical sequences A0A024RB32 A0A1S3ADL4 A0A1S3FN45 A0A1U7UEQ3 A0A250XVD8 A0A2I2UJD5 A0A2I2ZAY2 A0A2I3LI94 A0A2J8UHK5 A0A2K5EFJ0 A0A2K6C2F8 A0A2K6GXP0 A0A2K6PSW3 A0A2K6S5B2 F1SL99 F7C8H0 G1S6N9 G1TGF1 G2HGL4 H9EM56 Q15185 Q25KC4 Q3ZBF7 Q5NVM4 Q6PWL5
ENSNLEP00000021178 ENSDNOP00000008762 ENSGGOP00000026818 ENSPVAP00000007201 gi|23308579|ref|NP_006592.3| ENSPVAP00000007201 400325 APC89510 NP_001007807.2.59421 NP_001007807.2.76553 NP_001127087.1.23681 NP_001233331.1.37143 NP_001248443.1.72884 NP_001270588.1.63531 NP_006592.3.87134 NP_006592.3.92137 XP_001929448.3.46622 XP_002710382.1.1745 XP_002711223.2.1745 XP_002718103.1.1745 XP_002752663.2.60252 XP_003252840.1.23891 XP_003824954.1.60992 XP_003945090.1.74449 XP_003988965.1.62641 XP_004053434.1.27298 XP_004274182.1.21590 XP_004316174.1.83887 XP_004379968.1.4749 XP_004401749.1.74151 XP_004466204.1.11602 XP_004589738.1.84141 XP_004700599.1.18182 XP_005335703.1.77405 XP_005872133.1.60319 XP_005903510.1.15283 XP_005960804.1.78601 XP_006075048.1.26621 XP_006093678.1.53796 XP_006218662.1.17985 XP_006777949.1.95426 XP_006859513.1.41390 XP_006897673.1.29581 XP_006908982.1.64745 XP_007129454.1.24612 XP_007179688.1.59432 XP_007467760.1.90284 XP_007533384.1.11023 XP_007953335.1.48129 XP_008001892.1.81039 XP_008070754.1.4292 XP_008146881.1.99482 XP_008681905.1.72690 XP_010376073.1.97406 XP_010642954.1.5607 XP_010837574.1.44457 XP_010962125.1.22495 XP_011373943.1.92234 XP_011726874.1.29376 XP_012016021.1.54773 XP_012305927.1.9421 XP_012377018.1.11602 XP_012506424.1.63892 XP_012609597.1.48125 XP_012877775.1.60039 XP_014438478.1.99106 XP_015338660.1.40921 XP_016021197.1.101085 XP_016043132.1.11023 XP_016080001.1.3490 XP_016778676.1.37143 XP_017507425.1.32401 XP_017903546.1.57651 XP_019310356.1.44245 XP_019524691.1.44202 XP_019597973.1.88060 XP_019816566.1.53367 XP_020018849.1.5219 XP_020739784.1.74333 XP_021542939.1.83697 ENSPTRP00000008687 ENSP00000262033 ENSSSCP00000000433 ENSPPYP00000005319 ENSOCUP00000016001 ENSOCUP00000021652 ENSPTRP00000008687 ENSBTAP00000023908 ENSSSCP00000000433 ENSMMUP00000018100 9361.ENSDNOP00000008762 9544.ENSMMUP00000018100 9598.ENSPTRP00000008687 9600.ENSPPYP00000005319 9606.ENSP00000262033 9615.ENSCAFP00000000204 9913.ENSBTAP00000023908 9986.ENSOCUP00000016001 9986.ENSOCUP00000021652 ENSDNOP00000026241 ENSGGOP00000026818 ENSCJAP00000019830 ENSP00000262033 ENSMMUP00000018100 ENSBTAP00000023908 ENSP00000262033 ENSOCUP00000021652 ENSPPYP00000005319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]