SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026848 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026848
Domain Number 1 Region: 450-487
Classification Level Classification E-value
Superfamily E set domains 0.0000406
Family SVA-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026848   Gene: ENSGGOG00000015469   Transcript: ENSGGOT00000027317
Sequence length 488
Comment pep:novel chromosome:gorGor3.1:12:31554343:31575458:-1 gene:ENSGGOG00000015469 transcript:ENSGGOT00000027317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPQNNRIFQWQNVTSFRNITQLSFQLISEPMFGDYWIVVKRNSRKTVTHQFAVKRYVLPK
FEVTVNAPQTVTISDDEFQVDVCALKFSDPSNVPMVNKLLQLELNDEFIGNYTTDENGEA
QFSIDTSDIFDPEFNLKATYVRPKSCYLPSWLTPQYLDAHFLVSRFYSRTNSFLKIVPEP
KQLECNQQKVVTVHYSLNSEAYEDDSNVKFFYLVTWNGNFLFPISISADLAPAAVLFVYT
LHPSGEIVADSVRFQVDKCFKHKVNIKFSNEQGLPGSNASLYLQAAPDLFCALGAVDRNV
LLLKSEQQLSAESQGTVYNMVPSIEPYGYCYHGLNLDDGKEDPCIPQRDMFYNGLYYTPV
SNCGDGDIYNIVRVRSLRILENISWQFLAIIQTVRTNFPETWMWDLVSVDSSGSANLLFL
IPDTVTQWEASGFCVNGDVGFGISSTTTLEVSQPFFIEIASPFSVVQNEQFDLIVNVFSY
LNTCVEVS
Download sequence
Identical sequences ENSGGOP00000026848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]