SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026877 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026877
Domain Number 1 Region: 23-101
Classification Level Classification E-value
Superfamily DEATH domain 7.18e-20
Family Pyrin domain, PYD 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026877   Gene: ENSGGOG00000009112   Transcript: ENSGGOT00000009148
Sequence length 103
Comment pep:known_by_projection chromosome:gorGor3.1:16:31985445:31986571:-1 gene:ENSGGOG00000009112 transcript:ENSGGOT00000009148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPRRLRGAGLSHGNEARGHLKVLENLTPEELKKFKMKLGTVPLREGFARIPRGALGQ
LDIVDLTDKLVASYYEDYAAELVVAVLRDMRMLEEAARLQRAA
Download sequence
Identical sequences ENSGGOP00000026877 ENSGGOP00000026877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]