SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026878 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026878
Domain Number 1 Region: 208-390
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.22e-35
Family Reprolysin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 414-487
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000000000000196
Family Blood coagulation inhibitor (disintegrin) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026878   Gene: ENSGGOG00000024177   Transcript: ENSGGOT00000028009
Sequence length 718
Comment pep:novel chromosome:gorGor3.1:14:51644423:51646617:-1 gene:ENSGGOG00000024177 transcript:ENSGGOT00000028009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASLFMGPAWVQDLLTGALWLPVLWALLSQVYCFHDPPGWRFTSSEIVIPRKVPHRRGGVE
MPDQLSYSMRFRGLRHVIHMKLKKNMMPRHLPVFTDNDQGAMQENYPFVPRDCYYDCYLE
GVPGSVATLDTCRGGLRGMLQVDDLTYEIKPLEASSKFEHVVSLLVSEERPGEASRCKTE
GEEIDQESEKVKLAETPRAGHVYLWRHHRKNLKIHYTVTRGLFMRNPNVSHIIENVVIIN
SIIHTIFKPVYLNVYIRVLCIWNQKDAVLFSASRPGHVAVELFGVWKYHNLYSEISHDTS
VVFTSNFDGICNPNWGAMFVYIMRYHLFRGACVTAHALGHNMGLTHDSVGCYCFRRTNCL
MAPVPDLNYMMSNCSYEIIQHKFNQWDPCLSAPNVPYTNFPYVAPRCGDKIKNQREECDC
GSLKDCASDRCCEASCTLSLGRVCNGLCCHKCKYAAPGVVCRDLGGICDLREYCDGKKEE
CPNDIYIQDGTPCSAVSVCIRGNCSDHDMQCQALFGYQVKDGSPACYQKLNRIGNRFGNC
GVRGSRPFPCEEDDVFCGMLHCSSVSHIPGGGEHTTFRNILVHDIKEEKCFGYEAHQGTD
LPEMGLVVDGATCGPGSYCLKRNCTFYQDLHFECDLKTCNYKGVCNNKKHCHCLHEWQPP
TCELRGKGGSIDSGPPPDKQYRIAGSILVNTNRALVLICICYILFVVSLLFGGFSQAI
Download sequence
Identical sequences ENSGGOP00000026878 ENSGGOP00000026878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]