SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026904 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026904
Domain Number 1 Region: 48-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000129
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 318-364
Classification Level Classification E-value
Superfamily RING/U-box 0.000000127
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 261-297
Classification Level Classification E-value
Superfamily SAP domain 0.0000168
Family SAP domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026904   Gene: ENSGGOG00000009889   Transcript: ENSGGOT00000026876
Sequence length 370
Comment pep:known_by_projection chromosome:gorGor3.1:12:121275875:121300160:1 gene:ENSGGOG00000009889 transcript:ENSGGOT00000026876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNIVC
KACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKD
LRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSN
YTAPSATMSSFQGELMDGEQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAEDR
NPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLYKE
NEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICRQY
VVRAVHVFKS
Download sequence
Identical sequences ENSGGOP00000026904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]