SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026905 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026905
Domain Number 1 Region: 253-293
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000136
Family LIM domain 0.00049
Further Details:      
 
Domain Number 2 Region: 220-252
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000908
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026905   Gene: ENSGGOG00000014541   Transcript: ENSGGOT00000029674
Sequence length 749
Comment pep:known_by_projection chromosome:gorGor3.1:2b:54885000:55011964:1 gene:ENSGGOG00000014541 transcript:ENSGGOT00000029674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPESGHSRIFEATAGPNKPESGFAEDSAARGEGVSDLHEVVSLKERMARYQAAVSRGDC
RSFSANMMEESEMCTVPGGLAKVKKQFEDEITSSRNTFAQYQYQHQNRSEQEAIRSSQVG
TSRSSQEMARNEQEGSKVQKIDVHGTEMVSHLEKHTEEVNQTSQFHQYVQETVIDTPEDE
EIPKVSTKLLKEQFEKSAQEKILYSDKEMTTPVKQIKKLLLQDKEICILCQKTVYPMECL
VADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDEGFGHKQHKD
RWNCKNQSRSVDFIPNEEPNMCKNTAENTLVPGDRNEHLDAANSEGQRNDLRKLGERGKL
KVIWPPSKEIPKKTLPFEEELKMSKPKWPPEMTTVLSPEFKSESVLEDVRTPENKGQRQD
HLPFLQPYLQSTHVCQKEDVIGIKEMKMNVQDRLSEAEDTKSNRKSAMDLNDINVVVQSA
EKEKNEKTNQTNGAEVLQVTNTDDEMMPENHKENLNKNNNNNYVAVSYLNNCRQKTSILE
FPDLLPLSSEANDTANEYEIEKLENTSRISELLGIFESEKTYSRNVLAMALKKQTDRAAA
GSPVQPAPKPSLSRGLMVKRGSSIISPDTNLLNIKGSHSKSKNLQFFFSNTVKITAFSKK
NENIFNCGLIDSVEQIKNMPCLDLREFGKDVKHWHGETIEAACNNGNTGFDALSHECTAK
PLFPRVEVQSEQLTVEEQIKRNRCYSDTE
Download sequence
Identical sequences ENSGGOP00000026905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]