SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026938 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026938
Domain Number 1 Region: 1274-1387
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-45
Family Noncollagenous (NC1) domain of collagen IV 0.00000273
Further Details:      
 
Domain Number 2 Region: 1168-1273
Classification Level Classification E-value
Superfamily C-type lectin-like 7.77e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026938   Gene: ENSGGOG00000002973   Transcript: ENSGGOT00000029058
Sequence length 1389
Comment pep:known_by_projection chromosome:gorGor3.1:X:105549061:105834632:-1 gene:ENSGGOG00000002973 transcript:ENSGGOT00000029058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNPGDP
GVPGLPGLKGDEGIQGVRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIGAAG
LPGRDGLPGPPGPPGPPTKGPEFETETLHNKEPGFPGLRGEQGPKGNLGLKGIKGDSGFC
ACDGGVPNTGPPGEPGPPGPRGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGPK
GKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEKG
LPGLPGETGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIPGS
YGPSGFPGTPGFPGPKGSRGLPGIPGQPGSSGTKGEPGSRGLVHLPELPGFPGPRGEKGL
PGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSGLP
GLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGTSGHP
GKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKGSV
GFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRRPM
SNLWLKGDKGSQGSAGSNGFPGPRGDKGDAGRPGPPGLPGAPGLPGIIKGVSGNPGPPGF
MGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGSPG
PKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMKGEPG
LPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPAGL
PGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGDPG
RPGLDGERGHPGPPGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGFPGELG
LKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGPQGAPGQTPTAEAVQVPPGPL
GLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQGPP
GFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEGQE
KAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQIP
QYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVSPG
SCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTRVS
RCQVCMKSL
Download sequence
Identical sequences ENSGGOP00000026938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]