SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026959 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000026959
Domain Number - Region: 20-26
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026959   Gene: ENSGGOG00000004057   Transcript: ENSGGOT00000028085
Sequence length 827
Comment pep:known_by_projection chromosome:gorGor3.1:1:112950795:112973849:1 gene:ENSGGOG00000004057 transcript:ENSGGOT00000028085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAVCGPGPLIVNNKQPQPPPPPPPAAAQPPLPGGKAREFNRNQRKDSEGYSESPDLEF
EYADTDKWAAELSELYSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLL
DGLEVTAREKRLKVARAILYVAQGTFGECSSEAEVQSWMRYNIFLLLEVGTFNALVELLN
MEIDNSAACSSAVRKPAISLADSTDLRVLLNIMYLIVETVHQECEGDKAEWRTMRQTFRA
ELGSPLYNNEPFAIMLFGMVTKFCSGHAPHFPMKKVLLLLWKTVLCTLGGFEELQSMKAE
KRSILGLPPLPEDSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNER
DPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVRE
KDIEMFLESSRSKFIGYTLGSDTNTVVGLPRPIHESIKTLKQKDYITSPSAQAETVQGLL
LSSLTSGEEEVEQVPAETLYQGLLPSLPQYMIALLKILLAAAPTSKAKTDSINILADVLP
EEMPTTVLQSMKLGVDVNRHKEVIVKAISAVLLLLLKHFKLNHVYQFEYMAQHLVFANCI
PLILKFFNQNIMSYITAKNSISVLDYPHCVVHELPELTAESLEAGDSNQFCWRNLFSCIN
LLRILNKLTKWKHSRTMMLVVFKSAPILKRALKVKQAMMQLYVLKLLKVQTKYLGRQWRK
SNMKTMSAIYQKVRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNP
DFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ
Download sequence
Identical sequences ENSGGOP00000003985 ENSGGOP00000026959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]