SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026982 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026982
Domain Number 1 Region: 26-165
Classification Level Classification E-value
Superfamily EF-hand 4.15e-42
Family Calmodulin-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026982   Gene: ENSGGOG00000011429   Transcript: ENSGGOT00000031240
Sequence length 172
Comment pep:novel chromosome:gorGor3.1:18:3266569:3269558:1 gene:ENSGGOG00000011429 transcript:ENSGGOT00000031240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Download sequence
Identical sequences A0A250YB15
ENSGGOP00000026982 ENSGGOP00000026982 ENSOPRP00000008967 ENSOPRP00000008967 XP_004579678.1.84141 XP_012780828.1.84141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]