SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026987 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026987
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.64e-109
Family STAT DNA-binding domain 0.000000000254
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 9.22e-66
Family STAT 0.00000000861
Further Details:      
 
Domain Number 3 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-44
Family SH2 domain 0.0000000878
Further Details:      
 
Domain Number 4 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.66e-44
Family Transcription factor STAT-4 N-domain 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026987   Gene: ENSGGOG00000000611   Transcript: ENSGGOT00000031284
Sequence length 750
Comment pep:known_by_projection chromosome:gorGor3.1:2b:79204350:79258664:-1 gene:ENSGGOG00000000611 transcript:ENSGGOT00000031284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Download sequence
Identical sequences A0A2I2YUU6 A0A2J8WVT1 K7BS59 P42224
ENSP00000376136 9600.ENSPPYP00000014555 9606.ENSP00000354394 ENSP00000354394 ENSP00000386244 gi|6274552|ref|NP_009330.1| ENSP00000354394 ENSP00000386244 NP_009330.1.87134 NP_009330.1.92137 XP_003825332.1.60992 XP_006712781.1.92137 XP_008948870.1.60992 XP_016805706.1.37143 XP_016805707.1.37143 XP_018877552.1.27298 ENSGGOP00000026987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]