SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000026992 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000026992
Domain Number 1 Region: 54-146
Classification Level Classification E-value
Superfamily Mitochondrial import receptor subunit Tom20 3.27e-33
Family Mitochondrial import receptor subunit Tom20 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000026992   Gene: ENSGGOG00000025184   Transcript: ENSGGOT00000031304
Sequence length 147
Comment pep:known_by_projection chromosome:gorGor3.1:1:215364466:215381981:-1 gene:ENSGGOG00000025184 transcript:ENSGGOT00000031304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKMVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLP
DLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPV
FQMLLTKLPTISQRIVSAQSLAEDDVE
Download sequence
Identical sequences L8I7A4
ENSGGOP00000026992 ENSGGOP00000026992 9913.ENSBTAP00000000733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]