SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027001 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027001
Domain Number 1 Region: 371-449
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000145
Further Details:      
 
Domain Number 2 Region: 38-110
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000495
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027001
Domain Number - Region: 281-336
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027001   Gene: ENSGGOG00000027874   Transcript: ENSGGOT00000029214
Sequence length 455
Comment pep:novel chromosome:gorGor3.1:5:110802609:110803991:-1 gene:ENSGGOG00000027874 transcript:ENSGGOT00000029214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VETEQPEETFPNTETNGEFGKRPAEDMEEEQALKRSRNTDEMVELHILLQNKNAGAVIGE
GGKNIKAPCIDYSASVSVPDSSGPECILSISAGIETIGEILKKIIPTLEEGLQLPLLTAT
SQLLLESDAVECLNYQHYKGRDFECELKLLIYQSLAGGILGSKVLKSKNFERTLKQPSEC
CSHPTDRVVLIGGKPSRVECIKIILDLISESPIKGPAQPYDPSFHNETYDYGGFTMMFDD
HPGRPVVFPLWGRGGFDRMPPGWGRRPMPPSRRDISPHRGPPPPPTGRGGRGGSRARNLP
LPPPPPPRGEDLMAYDRRGRPGDCYDGMVGFSPDETWNSAIDTWSPSEWQMAYEPQGGSG
YDYSYAGIGGSYGDLGGPIITAKVTIPKDLTGSIIGKGGQRIKQIGHELGASIKIDEPLE
GSEEQIITITGTQDQIQNAQYLLQNNVKQYSGKFF
Download sequence
Identical sequences ENSGGOP00000027001 ENSGGOP00000027001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]