SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027030 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027030
Domain Number 1 Region: 167-290
Classification Level Classification E-value
Superfamily E set domains 3.64e-39
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000232
Further Details:      
 
Domain Number 2 Region: 64-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.81e-21
Family Voltage-gated potassium channels 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027030   Gene: ENSGGOG00000022873   Transcript: ENSGGOT00000031856
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:2b:42202197:42354803:1 gene:ENSGGOG00000022873 transcript:ENSGGOT00000031856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYRNITDKCPEGIILFLFQSILGSIVDAFLIGCMFI
KMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKMTCQARTS
YTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPA
ITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMSSTTSEKAYSLGDLPM
KLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGAARMEGNLPAKLRKM
NSDRFT
Download sequence
Identical sequences ENSGGOP00000027030 ENSGGOP00000027030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]