SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027053 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027053
Domain Number 1 Region: 845-944
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000983
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027053   Gene: ENSGGOG00000024250   Transcript: ENSGGOT00000023758
Sequence length 947
Comment pep:novel chromosome:gorGor3.1:5:45127941:45143752:-1 gene:ENSGGOG00000024250 transcript:ENSGGOT00000023758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAQCAVPAPVMSQLRLWVPRPLLRLATTAQPLEWVQDPLQPTSDPWGTEPWFSRSPSL
PPESPFALIPPADPGDFDYLGSSASSEMSAPPQESTETLTETLVPFLDTDSAAELAPGPE
QLAAAHQDLNDKLTWQERLPENLNKDLAKHLKLAKVVGTPHLFVSKPQCQKQTLQDEYLA
SSMGTVYPGSLPPELQMNSDESPGPPERVGLSQFHVEPETQNPETLEEISSSFQEEAPEQ
LPQLTEEAEPSTQQEAPAQPPESSTESAAQTPSKHEVTVHPPGEDQAHYNLPSVTVKPAD
VEITITSEPTKEAESSPSQQEIQTQPPEEVEASATQEEAPAEPPGPPMECAPSPSEQEQP
AQPSVFPGKAESSPAQQKAPAQPPEHHEVTVSPPGHRQAQHSDLPNVTIRPPDMQLTIAA
EPTAEVGSSPIHQEATAQLSGPGNDVEPSATQHGGAPLRPESSEDAGPLAGQQETSVQSP
EPVNNENPSPTQQEAAAEHPQTPEEAESSPAQQEAKPQVILQKPPEKSHLKSVTVQPLGL
GLTITPESTTEVELSPTIQETPTPPKEVVPQSPAYQEVTVPAPGQDQAQHPMSPSVIAQP
LDLGLTITPEPTTEVEHSTPPKKIPPKHPKVTLPHPDQVQTHHSNLTQVTVQPLDLELTI
TPESITKVEPSTALMTTAPPPENLEVSPPDKGQAQHSNLTQVTVQPLDLELTITIEPTID
VKPSPTTEETSTQSPDLGLAITPEPTTEIGYSTALEKTIAPRPDQVQTQHRNLTEVTGPP
TELEPTQDSLVQSETAPEEQKASTSTSICELCTCGDETLSCTDLSPKQRLRVPVPEPNTY
NGTFTILNFQGNYISYIGEDVWKAYSWTEKLILNENYLTELHRDSFEGLLSLQYWQDLSC
NKIQPIERRTFEPLPFLQFTNLGCNLLTELSFGTFQAWHGMQFLHKL
Download sequence
Identical sequences ENSGGOP00000027053 ENSGGOP00000027053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]