SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027117 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027117
Domain Number 1 Region: 246-308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.86e-19
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 188-243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000393
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 3 Region: 131-183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000904
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 2-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000011
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 5 Region: 68-127
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000603
Family Complement control module/SCR domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027117   Gene: ENSGGOG00000012348   Transcript: ENSGGOT00000033255
Sequence length 309
Comment pep:known_by_projection chromosome:gorGor3.1:1:176606649:176672545:1 gene:ENSGGOG00000012348 transcript:ENSGGOT00000033255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSCDFPDIKHGGLYYESMCRPYFPVAVGKSYSYYCDESFETPSGSYDYIHCTQDGWSPAV
PCLRKRYFPYLENGHNENYGRKFVQGNSIEVAFLPGYGLPNEQTTVTCMENGWSPPCRCI
RVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQP
ICINSSEKCGPPPPISNGGTTSFLLKVYVPQSRVEYQCQSYYELQGSNYVTCSNGEWSEP
PRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEFMCKLGYNANTSILSFQAVCRE
GIVEYPRCK
Download sequence
Identical sequences ENSGGOP00000027117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]