SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027123 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027123
Domain Number 1 Region: 344-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.67e-25
Family Clostridium neurotoxins, the second last domain 0.071
Further Details:      
 
Domain Number 2 Region: 152-258
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000157
Family Cadherin 0.0044
Further Details:      
 
Domain Number 3 Region: 40-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000101
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027123   Gene: ENSGGOG00000012405   Transcript: ENSGGOT00000022891
Sequence length 981
Comment pep:known_by_projection chromosome:gorGor3.1:1:9909855:10005966:-1 gene:ENSGGOG00000012405 transcript:ENSGGOT00000022891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNTVLLDPPLI
ALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCEL
QKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYD
SILRVEAVDADCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAY
DCGKKRATEDVLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQ
ATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTVGLPTDNGHDSD
QVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL
YVHGCRLIFLFRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHE
PFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASTGGDLHMTQFFRGNLA
GLTLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVLTLEGEDLGELDK
AMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGV
HHFARAVSEFESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTC
EVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNW
HARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPMEHANHMAAQPQFVHPEHRSFV
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQDTGKENE
MDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQ
GDPQNATRQQQLEWDDSTLSY
Download sequence
Identical sequences G3SG87
XP_018866285.1.27298 ENSGGOP00000027123 ENSGGOP00000012111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]