SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027133 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027133
Domain Number 1 Region: 601-744
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.88e-53
Family gamma-adaptin C-terminal appendage domain-like 0.000000119
Further Details:      
 
Domain Number 2 Region: 17-158
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.54e-47
Family VHS domain 0.000000136
Further Details:      
 
Domain Number 3 Region: 175-303
Classification Level Classification E-value
Superfamily GAT-like domain 3.14e-36
Family GAT domain 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027133   Gene: ENSGGOG00000007634   Transcript: ENSGGOT00000033156
Sequence length 744
Comment pep:known_by_projection chromosome:gorGor3.1:5:8015398:8034270:1 gene:ENSGGOG00000007634 transcript:ENSGGOT00000033156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGESLESWLILQDKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSP
QEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIEL
LYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKL
LAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLGEMLLHYSQ
EDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTII
EGQVINGEVATLTLPDSEGNSQCSNQGTLIDLVELDTTNSLSSVLAPAPTPPSSGIPILP
PPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQW
HLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAP
SAGSFLFSTGVAPALAPKVEPAVPGHHGLTLGDSALHHLDALDQLLEEAKVLEGKGWAWT
CFPSFLPPRTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPEL
SLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPV
KSIMLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFA
LGEQLSTEVGEVDQFPPVEQWGNL
Download sequence
Identical sequences ENSGGOP00000007469 ENSGGOP00000027133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]