SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027148 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027148
Domain Number 1 Region: 55-128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-16
Family Complement control module/SCR domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 112-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 3 Region: 180-227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 4 Region: 5-46
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000162
Family Complement control module/SCR domain 0.0000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027148   Gene: ENSGGOG00000000170   Transcript: ENSGGOT00000030003
Sequence length 229
Comment pep:known_by_projection chromosome:gorGor3.1:1:187773737:187819560:1 gene:ENSGGOG00000000170 transcript:ENSGGOT00000030003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIR
DPLNGQAIIANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCT
PPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPEC
KVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGFYLDGSDTIVCDS
Download sequence
Identical sequences ENSGGOP00000027148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]