SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027149 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027149
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.66e-36
Family Non-canonical RBD domain 0.00000514
Further Details:      
 
Domain Number 2 Region: 98-253
Classification Level Classification E-value
Superfamily L domain-like 6.12e-33
Family mRNA export factor tap 0.000000143
Further Details:      
 
Domain Number 3 Region: 269-351
Classification Level Classification E-value
Superfamily NTF2-like 1.17e-18
Family NTF2-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027149   Gene: ENSGGOG00000001911   Transcript: ENSGGOT00000031042
Sequence length 395
Comment pep:known_by_projection chromosome:gorGor3.1:11:59583591:59592522:-1 gene:ENSGGOG00000001911 transcript:ENSGGOT00000031042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDA
STASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQA
LDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSI
VQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFP
KLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQSSLAEYFKDSRNV
KKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDINSFVVDISAQTVSSCLRLTGLELGWG
CRCFLLQWMESPGILCEPSPGRSLLFLLAIQGYVL
Download sequence
Identical sequences ENSGGOP00000027149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]