SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027164 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000027164
Domain Number - Region: 12-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0675
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027164   Gene: ENSGGOG00000023158   Transcript: ENSGGOT00000026419
Sequence length 207
Comment pep:known_by_projection chromosome:gorGor3.1:3:171387518:171402989:1 gene:ENSGGOG00000023158 transcript:ENSGGOT00000026419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
Download sequence
Identical sequences A0A2I2ZIY0 H2PBZ5
XP_002814320.1.23681 XP_004038046.1.27298 ENSGGOP00000027164 ENSGGOP00000027164 9600.ENSPPYP00000015975 ENSPPYP00000015975 ENSPPYP00000015975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]