SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027288 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027288
Domain Number 1 Region: 13-40,89-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-24
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.29e-16
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027288   Gene: ENSGGOG00000007626   Transcript: ENSGGOT00000034342
Sequence length 322
Comment pep:known_by_projection chromosome:gorGor3.1:6:40409761:40417186:-1 gene:ENSGGOG00000007626 transcript:ENSGGOT00000034342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLATIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGHPLNFITPSGLLPSQEPFQ
TPHGKPESQQIPGSFQKVSSMNVWPLSGMHSPGLAFPLPDCNIPDQERFRPLHPGAWKFW
PLPLPSSNSKWAPMWLGSSAQV
Download sequence
Identical sequences G3SGQ1
ENSGGOP00000027288 ENSGGOP00000027288 XP_004044008.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]