SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027307 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000027307
Domain Number - Region: 48-100
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.00994
Family Methicillin resistance protein FemA probable tRNA-binding arm 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027307   Gene: ENSGGOG00000024947   Transcript: ENSGGOT00000023577
Sequence length 123
Comment pep:novel chromosome:gorGor3.1:15:7285188:7287827:1 gene:ENSGGOG00000024947 transcript:ENSGGOT00000023577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVIIFYFYNPTGMQKEMEHDVKTFGQAAWATAIPRLEKLTLMLAQETLQLMRAKELCLNH
KRAEIQGKMEDLPEQEKNINVVDELEIQFYEIQLELYEVKFEILKNKEILLTTQLDSLKR
LIK
Download sequence
Identical sequences ENSGGOP00000027307 ENSGGOP00000027307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]