SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027346 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027346
Domain Number 1 Region: 118-364
Classification Level Classification E-value
Superfamily PA domain 1.44e-68
Family PA domain 0.00000713
Further Details:      
 
Domain Number 2 Region: 63-111,346-598
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.04e-66
Family FolH catalytic domain-like 0.0000142
Further Details:      
 
Domain Number 3 Region: 602-752
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 3.14e-37
Family Transferrin receptor-like dimerisation domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027346   Gene: ENSGGOG00000002695   Transcript: ENSGGOT00000024956
Sequence length 755
Comment pep:known_by_projection chromosome:gorGor3.1:11:61887690:61905648:-1 gene:ENSGGOG00000002695 transcript:ENSGGOT00000024956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIDQSYPSWPRVRRMQWTKVLGLGLGAAALLGLGIILGHFAIPKKANSPAPQDLDLEILE
TVMGQLDANRIRENLRELSREPHLASSPRDEDLVQLLLQRWKDPESGLDSAGASTYEVLL
SFPSQEQPNVVDIVGPTGGIIHSCHRTEENVTGEQGGPDVVQPYAAYAPSGTPQGLLVYA
NRGAEEDFKELQTQGIKLEGTIALTRYGGVGRGAKAVNAAKHGVAGVLVYTDPADINDGL
SSPDETFPNSWYLPPSGVERGSYYEYFGDPLTPYLPAVPSSFRVDLANVSGFPPIPTQPI
GFQDARDLLCNLNGTLAPATWQGALGCHYRLGPGFRPDGDFPADSQVNVSVYNRLELRNS
SNVLGIIRGAVEPDRYVLYGNHRDSWVHGAVDPSSGTAVLLELSRVLGTLLKKGTWRPRR
SIVFASWGAEEFGLIGSTEFTEEFFNKLQERTVAYINVDISVFANATLRVQGTPPVQTVV
FSATSQIRSPGPGDLSIYDNWIRYFNRSSPPSLTFSSTSLCSSMGAGGGGKLISALINSD
HWRERWHEGKNKTRIYPTYHTAFDTFDYVDKFLDPGFSSHQAVARTAGSVILRLSDSFFL
PLKVSDYSETLRSFLQAAQQDLGALLEQHSISLGPLVNAVEKFEAEAAALGQRISTLQKG
SPDPLQVRMLNDQLMLLERTFLNPRAFPEERYYSHVLWAPRTGSVVTFPGLSNACSRARD
TASGSEAWAEVQRQLSIVVTALEGAAATLRPVADL
Download sequence
Identical sequences ENSGGOP00000027346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]