SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027366 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027366
Domain Number 1 Region: 929-1213
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.95e-60
Family Eukaryotic proteases 0.0000000000683
Further Details:      
 
Domain Number 2 Region: 658-927
Classification Level Classification E-value
Superfamily vWA-like 9.79e-60
Family Integrin A (or I) domain 0.00000000153
Further Details:      
 
Domain Number 3 Region: 258-477
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-40
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 4 Region: 175-254
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000519
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 5 Region: 552-613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.000017
Further Details:      
 
Domain Number 6 Region: 619-675
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000012
Family Complement control module/SCR domain 0.0000237
Further Details:      
 
Domain Number 7 Region: 83-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 8 Region: 499-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000556
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 9 Region: 23-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000292
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027366   Gene: ENSGGOG00000002254   Transcript: ENSGGOT00000026022
Sequence length 1219
Comment pep:novel chromosome:gorGor3.1:6:32825264:32855476:1 gene:ENSGGOG00000002254 transcript:ENSGGOT00000026022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLMVLFCLLFVYTGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPGHCPNPGISLGAVRTGSRFGHGDKVRYRCSSNLV
LTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKGKSN
MGGSPKTAVDRIREILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQ
DTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKPKSQETCRGALISDQ
WVLTAAHCFRDGKDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGD
DIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVAL
NGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGVTT
TPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQTRTCRSTGSWSTL
KTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTC
QVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTC
QEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKRKIVLDP
SGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVS
DPDSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWNRTRHVII
LMTDGLHNMGGDPITVIDEIRDLLYIGKDHKNPREDYLDVYVFGVGPLVNQVNINALASK
KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPS
KGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKK
EAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPA
QDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGG
VSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINL
FQVLPWLKEKLQDEDLGFL
Download sequence
Identical sequences ENSGGOP00000027366 ENSGGOP00000028096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]