SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027371 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027371
Domain Number 1 Region: 310-438,469-622
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.22e-60
Family FMN-linked oxidoreductases 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027371
Domain Number - Region: 119-149
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00144
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 161-180
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0275
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027371   Gene: ENSGGOG00000027433   Transcript: ENSGGOT00000030264
Sequence length 655
Comment pep:known_by_projection chromosome:gorGor3.1:19:5946172:5952224:-1 gene:ENSGGOG00000027433 transcript:ENSGGOT00000030264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGTAEAPLENGGGGDSGAEALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVG
DPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQPQTQKRARGQNKGRPHVKPTHYDK
NRLCPSLIQESAAKCFFGDRCRFLHDVGRYLATKPADLGPRCVLFETLGRCPYGVTCRFA
GAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGQP
PGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPC
EKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRH
QCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTK
FQQIVRGMNQVRPATSSHWLPNNSPGPCLPPPPTVSHHLPPAWRLLPQLHGRSREQRYTK
LADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVAGIMIARGALLKPWLFTEIKE
QRHWDISSSERLDILRGFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLP
QRINERPPYYLGRDYLETLMASQRAADWIRISEMLLGPVPPNFAFLPKHKANAYK
Download sequence
Identical sequences ENSGGOP00000027371 ENSGGOP00000027371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]