SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000027385 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000027385
Domain Number 1 Region: 283-598
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.11e-39
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 700-869
Classification Level Classification E-value
Superfamily C-type lectin-like 3.78e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 79-201
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1006-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000027385
Domain Number - Region: 49-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000027385   Gene: ENSGGOG00000022249   Transcript: ENSGGOT00000032572
Sequence length 1050
Comment pep:known_by_projection chromosome:gorGor3.1:10:129053363:129430914:1 gene:ENSGGOG00000022249 transcript:ENSGGOT00000032572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGTPQPAAPGLWRSSWLLDGNSWLLCYGFLYLALYAQVSQSKPCERTGSCFS
GRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVL
RLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTSGYALLHF
FSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSVSVPSQVYCECDKYWKGEACDIPYCKA
NCGSPDHGYCDLTGEKLCVCNDSWQVGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKA
VLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGTLSRGPLQRYGHSLALYQQENIFM
YGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMELDSRDVVMI
IIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKA
LPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNG
AKCFSADFLAYDIVACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDIL
VYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCRPKTAASDDRCY
RYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTSCKSCSLN
LNCQWDQRQQECQALPAHLCGEGWSHIGDACLRVNSSRENYDNAKLYCYNLSGNLASLTT
SKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCA
YLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMW
CSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTG
RGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKNYEWSFIQCPACQCNGHSTCINNNVC
EQCKNLTTGKQCQDCMPGYYGDPTNGGQCT
Download sequence
Identical sequences ENSGGOP00000027385 ENSGGOP00000027385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]